The domain within your query sequence starts at position 1067 and ends at position 1131; the E-value for the Bravo_FIGEY domain shown below is 2.5e-12.
KRNRGGKYSVKEKEDLHPDPEVQSAKDETFGEYRKMVLKQKLLSWSSSRGRTFYSCTKNT LFDGS
Bravo_FIGEY |
---|
PFAM accession number: | PF13882 |
---|---|
Interpro abstract (IPR026966): | This is the very C-terminal region of nervous system cell adhesion molecules neuroglian, neurofascin, neural adhesion molecule L1, NrCAM and NgCAM [ (PUBMED:7961622) ]. It lies upstream of the IG and Fn3 domains and has the highly conserved motif FIGEY. The function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Bravo_FIGEY