The domain within your query sequence starts at position 12 and ends at position 77; the E-value for the Bromo_TP domain shown below is 4.5e-8.
APRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPTVDADDV RLAIQC
Bromo_TP |
---|
PFAM accession number: | PF07524 |
---|---|
Interpro abstract (IPR006565): | This domain is found in eukaryotic bromodomain containing transcription factors and PHD domain containing proteins ( IPR001965 ). This domain has a histone-like fold and is predicted to bind DNA [ (PUBMED:11779830) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Bromo_TP