The domain within your query sequence starts at position 275 and ends at position 326; the E-value for the Bromodomain domain shown below is 2.7e-8.
CSEILKEMLAKKHLPYAWPFYNPVDADALGLHNYYDVVKNPMDLGTIKVNTA
Bromodomain |
---|
PFAM accession number: | PF00439 |
---|---|
Interpro abstract (IPR001487): | Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [ (PUBMED:1350857) ]. Bromodomains can interact with acetylated lysine [ (PUBMED:9175470) ]. In some proteins, the classical bromodomain has diverged to such an extent that parts of the region are either missing or contain an insertion (e.g., mammalian protein HRX, Caenorhabditis elegans hypothetical protein ZK783.4, yeast protein YTA7). The bromodomain may occur as a single copy, or in duplicate. The precise function of the domain is unclear, but it may be involved in protein-protein interactions and may play a role in assembly or activity of multi-component complexes involved in transcriptional activation [ (PUBMED:7580139) ]. |
GO function: | protein binding (GO:0005515) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Bromodomain