SMART: Pfam domain Btz

The domain within your query sequence starts at position 124 and ends at position 192; the E-value for the Btz domain shown below is 3.1e-4.

RARGRGWGRGNYSGNNNNNSNNDFQKRSREEEWDPEYTPKSKKYYLHDDREGEGSDKWMG
RGRGRGAFP

Btz

PFAM accession number:	PF09405
Interpro abstract (IPR018545):	This domain is found on CASC3 (cancer susceptibility candidate gene 3 protein, also known as MLN51) which is also known as Barentsz (Btz). CASC3 is a component of the EJC (exon junction complex) which is a complex that is involved in post-transcriptional regulation of mRNA in metazoa. The complex is formed by the association of four proteins (eIF4AIII, Barentsz, Mago, and Y14), mRNA, and ATP. This domain wraps around eIF4AIII and stacks against the 5' nucleotide [ (PUBMED:16923391) (PUBMED:14973490) ].

PFAM accession number:

PF09405

Interpro abstract (IPR018545):

This domain is found on CASC3 (cancer susceptibility candidate gene 3 protein, also known as MLN51) which is also known as Barentsz (Btz). CASC3 is a component of the EJC (exon junction complex) which is a complex that is involved in post-transcriptional regulation of mRNA in metazoa. The complex is formed by the association of four proteins (eIF4AIII, Barentsz, Mago, and Y14), mRNA, and ATP. This domain wraps around eIF4AIII and stacks against the 5' nucleotide [ (PUBMED:16923391) (PUBMED:14973490) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Btz