SMART: Pfam domain Bud13

The domain within your query sequence starts at position 478 and ends at position 620; the E-value for the Bud13 domain shown below is 2.8e-52.

ETVFRDKSGRKRNLKLERLEQRRKAEKDSERDELYAQWGKGLAQSRQQQQNVEDAMKEMQ
KPLARYIDDEDLDRMLREQEREGDPMANFIKKNKAKENKNKKVKPRYSGPAPPPNRFNIW
PGYRWDGVDRSNGFEQKRFARLA

Bud13

PFAM accession number:	PF09736
Interpro abstract (IPR018609):	Bud site selection protein 13, also known as pre-mRNA-splicing factor CWC26, belongs to the pre-mRNA retention and splicing (RES) complex. May also be involved in positioning the proximal bud pole signal [ (PUBMED:8657162) (PUBMED:11452010) (PUBMED:12871902) ]. The presence of RES subunit homologues in numerous eukaryotes suggests that its function is evolutionarily conserved [ (PUBMED:15565172) ].

PFAM accession number:

PF09736

Interpro abstract (IPR018609):

Bud site selection protein 13, also known as pre-mRNA-splicing factor CWC26, belongs to the pre-mRNA retention and splicing (RES) complex. May also be involved in positioning the proximal bud pole signal [ (PUBMED:8657162) (PUBMED:11452010) (PUBMED:12871902) ]. The presence of RES subunit homologues in numerous eukaryotes suggests that its function is evolutionarily conserved [ (PUBMED:15565172) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Bud13