The domain within your query sequence starts at position 218 and ends at position 334; the E-value for the C-C_Bond_Lyase domain shown below is 2.9e-10.
QDILYARQKVVVTAKAFGLQAIDLVYIDFRDEDGLLRQSREAAAMGFTGKQVIHPNQIAV VQEQFTPTPEKIQWAEELIAAFKEHQQLGKGAFTFRGSMIDMPLLKQAQNIVTLATS
C-C_Bond_Lyase |
 |
|---|
| PFAM accession number: | PF15617 |
|---|---|
| Interpro abstract (IPR039480): | This family of TIM-Barrel fold C-C bond lyase is related to citrate-lyase. These genes are found in the biosynthetic operon, with other enzymatic domains, associated with the Ter stress response operon and are predicted to be involved in the biosynthesis of a ribo-nucleoside involved in stress response [ (PUBMED:23044854) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry C-C_Bond_Lyase