The domain within your query sequence starts at position 507 and ends at position 539; the E-value for the C1_1 domain shown below is 3.4e-8.
HNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKG
C1_1 |
 |
|---|
| PFAM accession number: | PF00130 |
|---|---|
| Interpro abstract (IPR002219): | Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) [ (PUBMED:1396661) ]. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [ (PUBMED:2500657) ] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain. |
| GO process: | intracellular signal transduction (GO:0035556) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry C1_1