The domain within your query sequence starts at position 221 and ends at position 293; the E-value for the C8 domain shown below is 1.1e-8.
VQYCDKIIETYFEKCSKVSPLSREYKNVCADEYCRKGGGKQTTCDTYSELARLCAYDGPG DYEHWRDDSAVVC
C8 |
![]() |
---|
PFAM accession number: | PF08742 |
---|---|
Interpro abstract (IPR014853): | The proteins in this entry contained a domain rich in positionally conserved cysteine residues. Most proteins contains 7 or 8 cysteine residues. The domain is found in disease-related proteins including von Willebrand factor, Alpha tectorin, Zonadhesin and Mucin. It is often found on proteins containing IPR001846 and IPR002919 . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry C8