The domain within your query sequence starts at position 1756 and ends at position 1845; the E-value for the CAC1F_C domain shown below is 2.8e-8.
GKGPTSRFLETPNSRNFEEHVPRNSAHRCTAPATAMLIQEALVRGGLDSLAADANFVMAT GQALADACQMEPEEVEVAATELLKQESPEG
CAC1F_C |
---|
PFAM accession number: | PF16885 |
---|---|
Interpro abstract (IPR031688): | This entry represents the C-terminal region of voltage-gated calcium channel subunit alpha in higher eukaryotes. The exact function of this domain is not known. This region lies immediately downstream from the CDB motif. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CAC1F_C