The domain within your query sequence starts at position 42 and ends at position 113; the E-value for the CAF1C_H4-bd domain shown below is 8.6e-18.
SEGEELVMDEEAYVLYHRAQTGAPCLSFDIVRDHLGDNRTELPLSLYLCAGTQAESAQSN RLMMLRMHNLHG
CAF1C_H4-bd |
![]() |
---|
PFAM accession number: | PF12265 |
---|---|
Interpro abstract (IPR022052): | This entry rerpesnts the N-terminal domain of the histone-binding protein RBBP4. Proteins containing this domain include members from the WD repeat RBAP46 (RBBP7)/RBAP48(RBBP4)/MSI1 family. RBBP4 is a subunit of the chromatin assembly factor 1 (CAF-1) complex. The CAF-1 complex is a conserved heterotrimeric protein complex that promotes histone H3 and H4 deposition onto newly synthesized DNA during replication or DNA repair; specifically it facilitates replication-dependent nucleosome assembly with the major histone H3 (H3.1). This domain is an alpha helix which sits just upstream of the WD40 seven-bladed beta-propeller in the human RBBP7 protein. RBBP7 folds into the beta-propeller and binds histone H4 in a groove formed between this N-terminal helix and an extended loop inserted into blade six [ (PUBMED:18571423) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CAF1C_H4-bd