SMART: Pfam domain CAGE1

The domain within your query sequence starts at position 1 and ends at position 318; the E-value for the CAGE1 domain shown below is 6.5e-167.

MSESETINVNGPSQDFSYSDSPFCMEASFSSSDLLQSETKNVKRGNESTHTFSEDIYSTE
GSLLGDINLGNYPESEQNQPANTRLSSLRQFEPICKFHWIEAFNDEMTVEDLRGAFSYSE
KPELPSQVYNDAADGSEKPDPFKEESSVESSISENKDELVPAPVRKSPRSLCLNYYRGEA
QPLTEAPFVRSAVVDVGLNISQPQSFLDKENVCKNGDNSSDRENCFEQLDLRAIYKAEEP
EVSSKEVQNSGEISELSVSHQEEVTEDGVDSLAITSPWSPAGIFKGSGPQDNSLRPDREV
SCEGLEPLEEDMALNEAL

CAGE1

PFAM accession number:	PF15066
Interpro abstract (IPR029381):	Cancer-associated gene protein 1 (CAGE-1) shows testis-specific expression among normal tissues and displays wide expression in a variety of cancer cell lines and cancer tissues [ (PUBMED:12531476) ]. CAGE-1 is predominantly expressed during post-meiotic stages. It localises to the acrosomal matrix and acrosomal granule showing it to be a component of the acrosome of mammalian spermatids and spermatozoa [ (PUBMED:15819420) ].

PFAM accession number:

PF15066

Interpro abstract (IPR029381):

Cancer-associated gene protein 1 (CAGE-1) shows testis-specific expression among normal tissues and displays wide expression in a variety of cancer cell lines and cancer tissues [ (PUBMED:12531476) ]. CAGE-1 is predominantly expressed during post-meiotic stages. It localises to the acrosomal matrix and acrosomal granule showing it to be a component of the acrosome of mammalian spermatids and spermatozoa [ (PUBMED:15819420) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CAGE1