The domain within your query sequence starts at position 11 and ends at position 87; the E-value for the CALCOCO1 domain shown below is 3.2e-30.
TSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHSKDWVGIFKVGWSTARDYYTFLWSP MPEHYVEGSTVNCVLAF
CALCOCO1 |
![]() |
---|
PFAM accession number: | PF07888 |
---|---|
Interpro abstract (IPR012852): | Calcium-binding and coiled-coil domain-containing protein 1 (Calcoco1) from Mus musculus ( Q8CGU1 ) binds to a highly conserved N-terminal domain of p160 coactivators, such as GRIP1 ( Q61026 ), and thus enhances transcriptional activation by a number of nuclear receptors. Calcoco1 has a central coiled-coil region with three leucine zipper motifs, which is required for its interaction with GRIP1 and may regulate the autonomous transcriptional activation activity of the C-terminal region [ (PUBMED:14690606) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CALCOCO1