The domain within your query sequence starts at position 14 and ends at position 96; the E-value for the CAMSAP_CH domain shown below is 7.9e-24.
YLWVDNIPLSRPKRNLSRDFSDGVLVAELIKFYFPKMVEMHNYVPANSLQQKLSNWGHLN RKVLNKLNFSVPDDVMRKIAQCS
CAMSAP_CH |
---|
PFAM accession number: | PF11971 |
---|---|
Interpro abstract (IPR022613): | This domain is the N-terminal CH domain from calmodulin-regulated spectrin-associated proteins - CAMSAP proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CAMSAP_CH