The domain within your query sequence starts at position 30 and ends at position 62; the E-value for the CAMSAP_CH domain shown below is 1.2e-6.

NAQLKKRPSVKPVQDLRQDLRDGVILAYLIEIV

CAMSAP_CH

CAMSAP_CH
PFAM accession number:PF11971
Interpro abstract (IPR022613):

This domain is the N-terminal CH domain from calmodulin-regulated spectrin-associated proteins - CAMSAP proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CAMSAP_CH