The domain within your query sequence starts at position 1 and ends at position 93; the E-value for the CARD_2 domain shown below is 1.2e-31.
MTAEQRQNLQAFRDYIKKILDPTYILSYMSSWLEDEEVQYIQAEKNNKGPMEAASLFLQY LLKLQSEGWFQAFLDALYHAGYCGLCEAIESWD
CARD_2 |
![]() |
---|
PFAM accession number: | PF16739 |
---|---|
Interpro abstract (IPR031964): | This entry represents the CARD domain found in the DDX58 protein (also known as RIG1), which is a key protein in the cellular chordates' sentinel system to detect viral infection. This domain is near the N terminus of RIG1 and interacts with its C-terminal domain [ (PUBMED:23063562) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CARD_2