The domain within your query sequence starts at position 64 and ends at position 129; the E-value for the CART domain shown below is 1.6e-39.

MLQIEALQEVLKKLKSKRIPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNS
FLLKCL

CART

CART
PFAM accession number:PF06373
Interpro abstract (IPR009106):

The cocaine and amphetamine regulated transcript (CART) is a brain-localised peptide that acts as a satiety factor in appetite regulation. CART was found to inhibit both normal and starvation-induced feeding, and completely blocks the feeding response induced by neuropeptide Y. CART is regulated by leptin in the hypothalamus, and can be transcriptionally induced after cocaine or amphetamine administration [ (PUBMED:9590691) ]. CART has also been suggested to activate ERK1 through interaction with a specific G-protein coupled receptor [ (PUBMED:15908120) ]. Posttranslational processing of CART produces an N-terminal CART peptide and a C-terminal CART peptide. The C-terminal CART peptide has been isolated from the hypothalamus, nucleus accumbens, and the anterior pituitary lobe in rats. C-terminal CART is the biologically active part of the molecule affecting food intake. The structure of C-terminal CART consists of a disulphide-bound fold containing a beta-hairpin and two adjacent disulphide bridges [ (PUBMED:11478874) ].

GO process:cellular response to starvation (GO:0009267), adult feeding behavior (GO:0008343), activation of MAPKK activity (GO:0000186), G protein-coupled receptor signaling pathway (GO:0007186), negative regulation of appetite (GO:0032099)
GO component:extracellular space (GO:0005615)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CART