The domain within your query sequence starts at position 1 and ends at position 111; the E-value for the CATSPERG domain shown below is 1.4e-44.
MVSRPAMSPVSPVWPRKPNLWAFWVLRLVLLLSLKSWAEDTLQHCTWLLVLNKFEKVGLH LSKDRFQDHEPIDTVAKVFQKLTDSPIDPSENYLSFPYYLQINFSCPGQLS
CATSPERG |
![]() |
---|
PFAM accession number: | PF15064 |
---|---|
Interpro abstract (IPR028246): | This family represents the gamma subunit of the CATSPER, or cation channel sperm-associated protein complex [ (PUBMED:19516020) ]. The complex appears only to be expressed in the flagellum of sperm, and it is activated at alkaline intracellular pH [ (PUBMED:21224844) ]. |
GO component: | CatSper complex (GO:0036128), sperm principal piece (GO:0097228) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CATSPERG