The domain within your query sequence starts at position 1 and ends at position 141; the E-value for the CBF_beta domain shown below is 4.3e-74.

MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQTRFQNACRDGRSEIAFVAT
GTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLHRLD
GMGCLEFDEERAQARRQQDPS

CBF_beta

CBF_beta
PFAM accession number:PF02312
Interpro abstract (IPR003417):

Core binding factor (CBF) is a heterodimeric transcription factor essential for genetic regulation of hematopoiesis and osteogenesis. The beta subunit binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including Murine leukemia virus, Polyomavirus enhancer, T-cell receptor enhancers etc. The beta subunit enhances DNA-binding ability of the alpha subunit in vitro and has been show to have a structure related to the OB fold [ (PUBMED:10404215) ]. Also included in this family are the Drosophila melanogaster brother and big brother proteins, which regulate the DNA-binding properties of Runt.

GO component:nucleus (GO:0005634)
GO function:transcription coactivator activity (GO:0003713)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CBF_beta