The domain within your query sequence starts at position 1 and ends at position 59; the E-value for the CBF_beta domain shown below is 2.7e-32.
MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQTRFQNACRDGRSEIVYLK
CBF_beta |
 |
|---|
| PFAM accession number: | PF02312 |
|---|---|
| Interpro abstract (IPR003417): | Core binding factor (CBF) is a heterodimeric transcription factor essential for genetic regulation of hematopoiesis and osteogenesis. The beta subunit binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including Murine leukemia virus, Polyomavirus enhancer, T-cell receptor enhancers etc. The beta subunit enhances DNA-binding ability of the alpha subunit in vitro and has been show to have a structure related to the OB fold [ (PUBMED:10404215) ]. Also included in this family are the Drosophila melanogaster brother and big brother proteins, which regulate the DNA-binding properties of Runt. |
| GO component: | nucleus (GO:0005634) |
| GO function: | transcription coactivator activity (GO:0003713) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CBF_beta