The domain within your query sequence starts at position 202 and ends at position 339; the E-value for the CBM_21 domain shown below is 9.2e-29.
RLRRQRVCLERVQCSQPPRAEVTGSGRVISCPGPRAVAVRYTFTEWRTFLDVPAELDPES VEPLPPLQSGDSGSKAEDSEEGPGTERFHFSLCLPPGLQPKEGEDAGAWGVAIHFAVCYR CEQGEYWDNNEGANYTLR
CBM_21 |
![]() |
---|
PFAM accession number: | PF03370 |
---|---|
Interpro abstract (IPR005036): | The carbohydrate binding type-21 or CBM21 domain is a 90-130 amino acid carbohydrate binding domain. The domain is named after proteins classified in carbohydrate-binding module (CBM) family 21 and is sometimes called starch-binding domain (SBD) [ (PUBMED:15939348) ]. The CBM21 domain occurs in several eukaryotic proteins implicated in glycogen metabolism. A glucoamylase active site region or alpha amylase catalytic domain can occur C-terminal to the CBM21 domain. The CBM21 domain of Rhizopus oryzae glucoamylase can bind to raw starch. Most conserved residues are located in a region with a length of 35 in the N-terminal part [ (PUBMED:9046081) ] and in a 15-25 residue motif II at the C terminus of the domain [ (PUBMED:9046081) (PUBMED:9045612) (PUBMED:16262690) ]. |
GO function: | protein binding (GO:0005515) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CBM_21