SMART: Pfam domain CC2-LZ

The domain within your query sequence starts at position 407 and ends at position 510; the E-value for the CC2-LZ domain shown below is 3.2e-33.

LKTIEELTKQQAEKVDKMLLQELSEKLELAEQALASKQLQMDEMKQTLAKQEEDLETMAV
LRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAILLKENNDIE

CC2-LZ

PFAM accession number:	PF16516
Interpro abstract (IPR032419):	NF-kappa-B essential modulator NEMO comprises two coiled-coil regions, denoted as CC1 and CC2, a leucine zipper (LZ), and a zinc finger (ZF). This entry represents the CC2-LZ domain that plays a regulatory role. It contains a ubiquitin-binding domain (UBD) and represents one region that contributes to NEMO oligomerisation. NEMO itself is an integral part of the IkappaB kinase complex and serves as a molecular switch via which the NF-kappaB signalling pathway is regulated [ (PUBMED:19854204) ].

PFAM accession number:

PF16516

Interpro abstract (IPR032419):

NF-kappa-B essential modulator NEMO comprises two coiled-coil regions, denoted as CC1 and CC2, a leucine zipper (LZ), and a zinc finger (ZF). This entry represents the CC2-LZ domain that plays a regulatory role. It contains a ubiquitin-binding domain (UBD) and represents one region that contributes to NEMO oligomerisation. NEMO itself is an integral part of the IkappaB kinase complex and serves as a molecular switch via which the NF-kappaB signalling pathway is regulated [ (PUBMED:19854204) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CC2-LZ