The domain within your query sequence starts at position 9 and ends at position 53; the E-value for the CCDC-167 domain shown below is 1.1e-16.

LGVAQEIDGLEEKLSRCRKDLEAVTSQLYRAELSPEDRERAKAAS

CCDC-167

CCDC-167
PFAM accession number:PF15188
Interpro abstract (IPR028194):

The function of this family of coiled-coil domain containing proteins, has not as yet been determined. This family of proteins is found in eukaryotes.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCDC-167