The domain within your query sequence starts at position 9 and ends at position 53; the E-value for the CCDC-167 domain shown below is 1.1e-16.
LGVAQEIDGLEEKLSRCRKDLEAVTSQLYRAELSPEDRERAKAAS
CCDC-167 |
![]() |
---|
PFAM accession number: | PF15188 |
---|---|
Interpro abstract (IPR028194): | The function of this family of coiled-coil domain containing proteins, has not as yet been determined. This family of proteins is found in eukaryotes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCDC-167