The domain within your query sequence starts at position 17 and ends at position 134; the E-value for the CCDC32 domain shown below is 3.4e-41.
DLWAEICSCLPSPAQEDVSDNAFSDSFMDSHPAGESHTAAADSAVQPAGKPWAPLHDSEV YLASLEKKLRRIKGLNEEVTSKDMLRTLAQAKKECWDRFLQEKLASEFFVDGLDSDER
CCDC32 |
![]() |
---|
PFAM accession number: | PF14989 |
---|---|
Interpro abstract (IPR028039): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 160 and 188 amino acids in length. The gene that encodes this protein is C15orf57, but its protein product is called CCDC32 (Coiled-coil domain containing protein 32). The exact function of this protein is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCDC32