The domain within your query sequence starts at position 1 and ends at position 131; the E-value for the CCDC50_N domain shown below is 1.8e-59.
MADVSVDQSKLPGVKEVCRDFAVLEDHTLAHSLQEQEIEHHLASNIQRNRLVQHDLQVAK QLQEEDLKAQAQLQKRYKALEQHDCEIAQEIQEKLTIEAERRRIQEKKDEDIARLLQEKE LQEEKRRKKHT
CCDC50_N |
---|
PFAM accession number: | PF15295 |
---|---|
Interpro abstract (IPR029311): | This entry represents the N-terminal domain of the coiled-coil domain-containing protein 50 (CCDC50). Human CCDC50 is overexpressed in mantle cell lymphoma and chronic lymphocytic leukemia. Its involvement in NFkappaB signalling pathways may have major effects on cell survival [ (PUBMED:19641524) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCDC50_N