The domain within your query sequence starts at position 209 and ends at position 326; the E-value for the CCDC74_C domain shown below is 1.4e-49.
PPHLRKPTTVQQCEVVIRQLWNANLLQAQELRHLKSLLEGNQRPKAAAEEAGLGSPKDQD TMQFPKVTSKGLSKKCLILSPMPAAERGILPALKQSLKNNFAERQKRLQVVQSRRLHR
CCDC74_C |
 |
|---|
| PFAM accession number: | PF14917 |
|---|---|
| Interpro abstract (IPR029422): | This entry represents the C-terminal conserved domain of coiled-coil proteins from animals. Its function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCDC74_C