The domain within your query sequence starts at position 18 and ends at position 79; the E-value for the CCDC92 domain shown below is 1.4e-26.
AQKRILDLEKSLQFLQQQHSETLVKLHEEIEHLKRENKDLHYKLIMNEKPQKKGSISTWS LH
CCDC92 |
 |
|---|
| PFAM accession number: | PF14916 |
|---|---|
| Interpro abstract (IPR039496): | This entry represents the coiled-coil domain found in uncharacterized proteins CCDC92 and CCDC74. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCDC92