The domain within your query sequence starts at position 18 and ends at position 74; the E-value for the CDC45 domain shown below is 7.9e-24.
RVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAYLEHKEQIKLLIK
CDC45 |
---|
PFAM accession number: | PF02724 |
---|---|
Interpro abstract (IPR003874): | CDC45 is an essential gene required for initiation of DNA replication in Saccharomyces cerevisiae (cell division control protein 45), forming a complex with MCM5/CDC46. Homologs of CDC45 have been identified in human [ (PUBMED:9660782) ], mouse and the smut fungus, Melampsora spp., (tsd2 protein) among others. |
GO process: | DNA replication initiation (GO:0006270) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDC45