SMART: Pfam domain CDC48

The domain within your query sequence starts at position 1 and ends at position 51; the E-value for the CDC48_N domain shown below is 1.5e-10.

MVRTSPNHKYIFTLRTHPSVVPGCIAFSLPQRKWAGLSIGQDIEVALYSFD

CDC48_N

PFAM accession number:	PF02359
Interpro abstract (IPR003338):	This entry represents the amino-terminal subdomain. The CDC48 N-terminal domain is a protein domain found in AAA ATPases including cell division protein 48 (CDC48), VCP-like ATPase (VAT) and N-ethylmaleimide sensitive fusion protein. It is a substrate recognition domain which binds polypeptides, prevents protein aggregation, and catalyses refolding of permissive substrates. It is composed of two equally sized subdomains. The amino-terminal subdomain forms a double-psi beta-barrel whose pseudo-twofold symmetry is mirrored by an internal sequence repeat of 42 residues. The carboxy-terminal subdomain forms a novel six-stranded beta-clam fold [ (PUBMED:10531028) ]. Together these subdomains form a kidney-shaped structure.

PFAM accession number:

PF02359

Interpro abstract (IPR003338):

This entry represents the amino-terminal subdomain.

The CDC48 N-terminal domain is a protein domain found in AAA ATPases including cell division protein 48 (CDC48), VCP-like ATPase (VAT) and N-ethylmaleimide sensitive fusion protein. It is a substrate recognition domain which binds polypeptides, prevents protein aggregation, and catalyses refolding of permissive substrates. It is composed of two equally sized subdomains. The amino-terminal subdomain forms a double-psi beta-barrel whose pseudo-twofold symmetry is mirrored by an internal sequence repeat of 42 residues. The carboxy-terminal subdomain forms a novel six-stranded beta-clam fold [ (PUBMED:10531028) ]. Together these subdomains form a kidney-shaped structure.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDC48_N