The domain within your query sequence starts at position 1 and ends at position 297; the E-value for the CDC73_N domain shown below is 3.4e-135.
MADVLSVLRQYNIQKKEIVVKGDEVIFGEFSWPKNVKTNYVVWGTGKEGQPREYYTLDSI LFLLNNVHLSHPVYVRRAATENIPVVRRPDRKDLLGYLNGEASTSASIDRSAPLEIGLQR STQVKRAADEVLAEAKKPRIEDEECVRLDKERLAARLEGHKEGIVQTEQIRSLSEAMSVE KIAAIKAKIMAKKRSTIKTDLDDDITALKQRSFVDAEVDVTRDIVSRERVWRTRTTILQS TGKNFSKNIFAILQSVKAREEGRAPEQRPAPNAAPVDPTLRTKQPIPAAYNRYDQER
CDC73_N |
![]() |
---|
PFAM accession number: | PF16050 |
---|---|
Interpro abstract (IPR032041): | This is the N-terminal region of Cdc73 (cell division cycle 73). Cdc73 forms part of the Paf1 post-initiation complex [ (PUBMED:9891041) ]. As part of the Paf1 complex, Cdc73 associates with RNA-polymerase II and is involved in several transcriptional and posttranscriptional events. In vertebrates, the protein encoded by HRPT2/CCdc73 is known as Parafibromin, and acts as a tumour suppressor [ (PUBMED:15580289) (PUBMED:16989776) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDC73_N