The domain within your query sequence starts at position 58 and ends at position 126; the E-value for the CDK2AP domain shown below is 1.4e-24.
GYVQAMKPPGSQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVREC LAETERNAR
CDK2AP |
 |
|---|
| PFAM accession number: | PF09806 |
|---|---|
| Interpro abstract (IPR017266): | This group represents the cyclin-dependent kinase 2-associated protein 1/2 (DOC-1/1R). DOC-1 is a specific inhibitor of the cell-cycle kinase CDK2 [ (PUBMED:10938106) ]. DOC-1R associates with CDK2 and inhibits CDK2 activation by obstructing its association with cyclin E and A [ (PUBMED:23781148) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDK2AP