The domain within your query sequence starts at position 164 and ends at position 330; the E-value for the CDK5_activator domain shown below is 2e-91.
QAAPPAPGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQ GWQDQAFITPANLVFVYLLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKP FLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQVFQDLKNEGE
CDK5_activator |
![]() |
---|
PFAM accession number: | PF03261 |
---|---|
Interpro abstract (IPR004944): | These proteins are neuron specific activators of cyclin-dependent kinase 5 (CDK5) [ (PUBMED:8090222) ]. They form a heterodimer with the catalytic subunit (CDK5) [ (PUBMED:11882646) ]. |
GO component: | protein kinase 5 complex (GO:0016533) |
GO function: | cyclin-dependent protein serine/threonine kinase activator activity (GO:0061575) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDK5_activator