The domain within your query sequence starts at position 431 and ends at position 525; the E-value for the CDT1_C domain shown below is 1.4e-30.
SQALLERIRAKEVQKQLARMTRCPEQELRLQRLERLPELARVLRNVFVSERKPALTMEVV CARMVDSCQTALSPGEMEKHLVLLAELLPDWLSLH
CDT1_C |
 |
|---|
| PFAM accession number: | PF16679 |
|---|---|
| Interpro abstract (IPR032054): | In eukaryotic replication licensing, Cdt1 plays a key role by recruiting the MCM2-7 complex onto the origin of chromosome. This entry represents the C-terminal domain of Cdt1 that binds to the MCM complex [ (PUBMED:19722278) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDT1_C