The domain within your query sequence starts at position 1 and ends at position 104; the E-value for the CDV3 domain shown below is 2.9e-55.
MQISEKEDDDNEKREDPGDNWEEGGGGSGAEKSSGPWNKTAPVQAPPAPVTVTETPEPAM PSGVYRPPGARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHVESR
CDV3 |
---|
PFAM accession number: | PF15359 |
---|---|
Interpro abstract (IPR026806): | Protein CDV3 (carnitine deficiency-associated protein 3) is up-regulated in ventricles of juvenile visceral steatosis mice [ (PUBMED:12359334) ]. Another study showed that CDV3 is phosphorylated by Abl, a tyrosine kinase involved in normal B cell development [ (PUBMED:12606058) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDV3