The domain within your query sequence starts at position 265 and ends at position 519; the E-value for the CENP-C_mid domain shown below is 5.4e-100.
MKLLEDEFIIDRSDRSFSSRLWVMIPSKDRHLSAHKPSPENTALLQGKKSREKSHSLSAM TFARNTQSDKAHPIEEAQLSVEENPATTCTDELENDCRSPENKMQSETAKTPPAWERTTK QSQRRVSKPKAAEELRKGQSSWENSNVSNTGQDKLQINSKRNMKDCEEVRNEPNPKKQKP ALENKKKTNSTQTNKEKSGKKFFSGGSKNKFVPKKVTLTSRRSCRISQRPSEWWRVKSDE SSVDRNPSKENNSPV
CENP-C_mid |
---|
PFAM accession number: | PF15620 |
---|---|
Interpro abstract (IPR028931): | CENP-C is a component of the centromere assembly complex in eukaryotes. CENP-C recruits the DNA methyltransferases DNMT3B, in order to establish the necessary epigenetic DNA-methylation essential for maintenance of chromatin structure and genomic stability. This entry represents the middle DNMT3B binding region of CENP-C. Binding of CENP-C and DNMT3B to DNA occurs at both centromeric and peri-centromeric satellite repeats. CENP-C and DNMT3B regulate the histone code in these regions [ (PUBMED:1) (PUBMED:2) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-C_mid