The domain within your query sequence starts at position 1 and ends at position 300; the E-value for the CENP-F_N domain shown below is 2.8e-144.
MSWALEEWKEGLPSRALQKIQELEGQLEKLKKEKQQRQFQLDSLEAALQKQKQKVEDGKT EGADLKRENQRLMEICEHLEKSRQKLSHELQVKESQVNLQESQLSSCKKQIEKLEQELKR CKSEFERSQQVAQSADVSLNPCSTPQKLFATPLTPSSTYEDLKEKYNKEVEERKRLEEEV KALHAKKVSLPVSQATMNHRDIARHQASSSVFPWQQENTPSRLSSDALKTPLRRDGSAAH FLGEEVSPNKSSMKTGRGDCSSLPGEPHSAQLLHQAKAQNQDLKSKMTELELRLQGQEKE
CENP-F_N |
![]() |
---|
PFAM accession number: | PF10481 |
---|---|
Interpro abstract (IPR018463): | Mitosin or centromere-associated protein-F (Cenp-F) is a coiled-coil protein that dimerizes and localizes to diverse subcellular locations, including microtubule plus-ends, mitochondria, nuclear pores, and kinetochores [ (PUBMED:32207772) ]. It localizes to kinetochores during mitosis and is then rapidly degraded after mitosis. It is required for kinetochore-microtubule interactions and spindle checkpoint function [ (PUBMED:17600710) ]. Cenp-F contains two microtubule-binding domains, and physically associates with dynein motor regulators [ (PUBMED:26101217) ]. Cenp-F has also been shown to couple mitochondria to dynamic microtubule tips [ (PUBMED:28701340) ]. This entry represents the N-terminal region of Cenp-F. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-F_N