The domain within your query sequence starts at position 2313 and ends at position 2449; the E-value for the CENP-F_leu_zip domain shown below is 1e-46.

DEKKHQNILEQLKESKHHADLLKDRVENLEQELILSEKNMIFQAEKSKAEIQTLKSEIQR
MAQNLQDLQLELISTRSENENLMKELKKEQERVSDLETINSSIENLLKDKEQEKVQMKEE
AKITVEMLQTQLKELNE

CENP-F_leu_zip

 CENP-F_leu_zip
PFAM accession number:PF10473
Interpro abstract (IPR019513):

Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [ (PUBMED:7542657) (PUBMED:14555653) ]. There are several leucine-rich repeats along the sequence of LEK1 that are considered to be zippers, though they do not appear to be binding DNA directly in this instance [ (PUBMED:14555653) ].

GO function:transcription factor binding (GO:0008134), dynein complex binding (GO:0070840), protein homodimerization activity (GO:0042803)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-F_leu_zip