SMART: Pfam domain CENP-N

The domain within your query sequence starts at position 3 and ends at position 337; the E-value for the CENP-N domain shown below is 3.4e-81.

ENVAEFLRRTILKIPLSEMKSILEAWDFLSEDQLQTINLKQRKDYLAQEVILLCEDKRAS
LDDVVLLDIVYTQFHRHQKLWNVFQMSKEPGEDVDLFDMEQFQSSFKRILQRALKNVTVS
FRVYEKDSVWIRVAWGTQYSQPNQYKPTFVVYYPQTPYAFISSCHLKNTVPLLHQALKVA
SKHHQIVHLDLRSRHLDSLKAIVFREYNQTCENYSSTTSLQEASLSMCLDSKITHENTEE
KVRVHRVTQETFGTYPQPQLEFAQYKLETKFKSNIGGGLLADRKEPFRCLVKFSSPHLLE
ALKSLAPAGIADAPLSPLLTCIPSKKMNYFKIRDK

CENP-N

PFAM accession number:	PF05238
Interpro abstract (IPR007902):	This family includes Chl4 from budding yeasts, mis15 from fission yeasts and centromere protein N (CENP-N) from animals. In Saccharomyces cerevisiae, Chl4 is an outer kinetochore structural component required for chromosome stability [ (PUBMED:12589047) ]. Chl4 is a component of the Ctf19 kinetochore complex that interacts with Ctf19p, Ctf3p, Iml3p and Mif2p [ (PUBMED:12589047) ]. It is required for establishing bipolar spindle-microtubule attachments and proper chromosome segregation [ (PUBMED:9339342) ]. In Schizosaccharomyces pombe, mis15 is a subunit of the Sim4 complex, which is required for loading the DASH complex onto the kinetochore via interaction with dad1 [ (PUBMED:21445296) ]. It is required for correct chromosome segregation where it has a role in the formation and/or maintenance of specialised chromatin at the centromere [ (PUBMED:16855021) ]. In humans, centromere protein N (CENP-N) is a component of the CENPA-NAC (nucleosome-associated) complex, which plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation [ (PUBMED:16716197) ]. CENP-N localises exclusively in the kinetochore domain of centromeres [ (PUBMED:16622419) ]. It is required for chromosome congression and efficiently align the chromosomes on a metaphase plate [ (PUBMED:19543270) ].
GO process:	chromosome segregation (GO:0007059), kinetochore assembly (GO:0051382)

PFAM accession number:

PF05238

Interpro abstract (IPR007902):

This family includes Chl4 from budding yeasts, mis15 from fission yeasts and centromere protein N (CENP-N) from animals.

In Saccharomyces cerevisiae, Chl4 is an outer kinetochore structural component required for chromosome stability [ (PUBMED:12589047) ]. Chl4 is a component of the Ctf19 kinetochore complex that interacts with Ctf19p, Ctf3p, Iml3p and Mif2p [ (PUBMED:12589047) ]. It is required for establishing bipolar spindle-microtubule attachments and proper chromosome segregation [ (PUBMED:9339342) ].

In Schizosaccharomyces pombe, mis15 is a subunit of the Sim4 complex, which is required for loading the DASH complex onto the kinetochore via interaction with dad1 [ (PUBMED:21445296) ]. It is required for correct chromosome segregation where it has a role in the formation and/or maintenance of specialised chromatin at the centromere [ (PUBMED:16855021) ].

In humans, centromere protein N (CENP-N) is a component of the CENPA-NAC (nucleosome-associated) complex, which plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation [ (PUBMED:16716197) ]. CENP-N localises exclusively in the kinetochore domain of centromeres [ (PUBMED:16622419) ]. It is required for chromosome congression and efficiently align the chromosomes on a metaphase plate [ (PUBMED:19543270) ].

GO process:

chromosome segregation (GO:0007059), kinetochore assembly (GO:0051382)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-N