The domain within your query sequence starts at position 1 and ends at position 74; the E-value for the CENP-O domain shown below is 2.1e-17.
MCISTAFEGNLLDSYFVDLVIEKPLRIHHHSVPVFIPLEKIAAAHLQTDVQRFLFRLWEY LNAYAGRKYQADQL
CENP-O |
![]() |
---|
PFAM accession number: | PF09496 |
---|---|
Interpro abstract (IPR018464): | This entry represents centromere protein O (CENP-O) and its homologues in yeasts, Mcm21 and Mal2. In humans, centromere protein O (CENP-O) is a component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation [ (PUBMED:16622419) ]. CENP-O mediates the attachment of the centromere to the mitotic spindle by forming essential interactions between the microtubule-associated outer kinetochore proteins and the centromere-associated inner kinetochore proteins. CENP-O modulates the kinetochore-bound levels of NDC80 complex [ (PUBMED:18007590) ]. It may be involved in incorporation of newly synthesized CENP-A into centromeres via its interaction with the CENPA-NAC complex [ (PUBMED:16622420) ]. In Saccharomyces cerevisiae, Mcm21 is a component of the kinetochore sub-complex COMA (Ctf19p, Okp1p, Mcm21p, Ame1p), which links kinetochore subunits with subunits bound to microtubules during kinetochore assembly [ (PUBMED:14633972) (PUBMED:22561346) ]. In Schizosaccharomyces pombe, Mal2 is a component of the Sim4 complex, which is required for loading the DASH complex onto the kinetochore via interaction with Dad1 [ (PUBMED:12242294) ]. It plays a role in the maintenance of core chromatin structure and kinetochore function [ (PUBMED:16079914) ]. |
GO process: | centromere complex assembly (GO:0034508) |
GO component: | kinetochore (GO:0000776) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-O