The domain within your query sequence starts at position 18 and ends at position 116; the E-value for the CENP-T_C domain shown below is 2.3e-12.
LKAAVHYTVGCLCQEVTLNKQVNFSKQTIAAISEVTFRQCENFAKDLEMFARHAKRSTVT TEDVKLLARRNNSLLKYITEKNEEIAQLNLKGKAKKKRK
CENP-T_C |
![]() |
---|
PFAM accession number: | PF15511 |
---|---|
Interpro abstract (IPR035425): | Histone H4 is one of the five histones, along with H1/H5, H2A, H2B and H3. Two copies of each of the H2A, H2B, H3, and H4 histones ensemble to form the core of the nucleosome [ (PUBMED:16472024) ]. The nucleosome forms octameric structure that wraps DNA in a left-handed manner. H3 is a highly conserved protein of 135 amino acid residues [ (PUBMED:8121801) (PUBMED:2041803) ]. Histones can undergo several different types of post-translational modifications that affect transcription, DNA repair, DNA replication and chromosomal stability. The sequence of histone H4 has remained almost invariant in more then 2 billion years of evolution [ (PUBMED:8121801) (PUBMED:6808351) (PUBMED:3340182) ]. This domain is the C-terminal histone fold domain of CENP-T, which associates with chromatin [ (PUBMED:21464230) (PUBMED:22304917) ]. Proteins containing this domain also include Histone H4. CENP-T is a family of vertebral kinetochore proteins that associates directly with CENP-W. The N terminus of CENP-T proteins interacts directly with the Ndc80 complex in the outer kinetochore. Importantly, the CENP-T-W complex does not directly associate with CENP-A, but with histone H3 in the centromere region. CENP-T and -W form a hetero-tetramer with CENP-S and -X and bind to a ~100 bp region of nucleosome-free DNA forming a nucleosome-like structure. The DNA-CENP-T-W-S-X complex is likely to be associated with histone H3-containing nucleosomes rather than with CENP-nucleosomes [ (PUBMED:22391098) (PUBMED:21464230) (PUBMED:22304917) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-T_C