The domain within your query sequence starts at position 1290 and ends at position 1417; the E-value for the CEP209_CC5 domain shown below is 3.8e-55.
TMIQLQNDKLKIMQEMKNSQQEHRNMENKTLELELKLKGLEELISTLKDARGAQKVINWH VKIEELRLQELKLNRELVKGKEEIKYLNNIISEYEHTINSLEEEIVQQSKFHEERQMAWD QREVELER
CEP209_CC5 |
---|
PFAM accession number: | PF16574 |
---|---|
Interpro abstract (IPR032321): | Cep290 and similar centrosomal proteins carry a number of coiled-coil regions, and this is the fifth along the length of the protein. It is thought that the proteins are involved in cilia biosynthesis [ (PUBMED:22940612) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CEP209_CC5