The domain within your query sequence starts at position 99 and ends at position 258; the E-value for the CEP76-C2 domain shown below is 4.1e-64.
TNVDPTRRYLYLQVLGGKAFLEHLQEPEPLPGQICSTFTLCLHYRNQRFRSKPVPCACEP DFHDGFLLEVHRESLGDGTRMADSTTMLSISDPIHMVLIKTDIFGETTLVASYFLEWRSV LGSENGVTNLTVELMGVGTESKVSVGILNIKLEMYPPLSQ
CEP76-C2 |
![]() |
---|
PFAM accession number: | PF15627 |
---|---|
Interpro abstract (IPR028926): | A C2 domain is usually involved in targeting proteins to cell membranes. This entry represents a C2 domain found in the CEP76 proteins [ (PUBMED:22983010) ]. CEP76 is a centrosomal protein involved in regulation of centriole duplication [ (PUBMED:19460342) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CEP76-C2