The domain within your query sequence starts at position 99 and ends at position 258; the E-value for the CEP76-C2 domain shown below is 4.1e-64.

TNVDPTRRYLYLQVLGGKAFLEHLQEPEPLPGQICSTFTLCLHYRNQRFRSKPVPCACEP
DFHDGFLLEVHRESLGDGTRMADSTTMLSISDPIHMVLIKTDIFGETTLVASYFLEWRSV
LGSENGVTNLTVELMGVGTESKVSVGILNIKLEMYPPLSQ

CEP76-C2

• PFAM accession number: PF15627
• Interpro abstract (IPR028926):

  A C2 domain is usually involved in targeting proteins to cell membranes. This entry represents a C2 domain found in the CEP76 proteins [ (PUBMED:22983010) ]. CEP76 is a centrosomal protein involved in regulation of centriole duplication [ (PUBMED:19460342) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CEP76-C2