SMART: Pfam domain CHD5

The domain within your query sequence starts at position 12 and ends at position 163; the E-value for the CHD5 domain shown below is 1.4e-36.

LLVLSFVFGCNLLRILLPSLSSFISRVLQKDAEQESQMRAEIQGMKQELSTVNMMDEFAR
YARLERKINKMTDKLKTHVKARTAQLAKIKWFISVAFYILQAALMISLIWKYYSVPVAVV
PSKWITPLDRLVAFPTRVAGGIGITCWILVCN

CHD5

PFAM accession number:	PF04420
Interpro abstract (IPR028945):	In budding yeasts, Golgi to ER traffic protein 1 (Get1) is a component of the Golgi to ER traffic (GET) complex, which is composed of Get1, Get2 and Get3. The GET complex mediates posttranslational insertion of newly synthesised tail-anchored (TA) proteins to the endoplasmic reticulum (ER) membrane.The GET complex is composed of the homodimeric Get3 ATPase and its heterooligomeric receptor, Get1/2. Get1 stabilises an open dimer conformation of Get3 [ (PUBMED:22684149) ]. In metazoa, the homologue to Get1 is known as tail-anchored protein insertion receptor WRB, which is a receptor for ASNA1/TRC40 (Get3 in yeast) [ (PUBMED:21444755) ].
GO process:	tail-anchored membrane protein insertion into ER membrane (GO:0071816)

PFAM accession number:

PF04420

Interpro abstract (IPR028945):

In budding yeasts, Golgi to ER traffic protein 1 (Get1) is a component of the Golgi to ER traffic (GET) complex, which is composed of Get1, Get2 and Get3. The GET complex mediates posttranslational insertion of newly synthesised tail-anchored (TA) proteins to the endoplasmic reticulum (ER) membrane.The GET complex is composed of the homodimeric Get3 ATPase and its heterooligomeric receptor, Get1/2. Get1 stabilises an open dimer conformation of Get3 [ (PUBMED:22684149) ].

In metazoa, the homologue to Get1 is known as tail-anchored protein insertion receptor WRB, which is a receptor for ASNA1/TRC40 (Get3 in yeast) [ (PUBMED:21444755) ].

GO process:

tail-anchored membrane protein insertion into ER membrane (GO:0071816)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CHD5