The domain within your query sequence starts at position 262 and ends at position 301; the E-value for the CIAPIN1 domain shown below is 3.3e-19.

AQSSQPKSACGNCYLGDAFRCANCPYLGMPAFKPGEQVLL

CIAPIN1

CIAPIN1
PFAM accession number:PF05093
Interpro abstract (IPR007785):

Anamorsin (also named CIAPIN1 for cytokine-induced anti-apoptosis inhibitor 1), is the human homologue of yeast Dre2, a conserved soluble eukaryotic Fe-S cluster protein, that functions in cytosolic Fe-S protein biogenesis [ (PUBMED:20802492) (PUBMED:21700214) ]. It is found in both the cytoplasm and in the mitochondrial intermembrane space (IMS) [ (PUBMED:18625724) ]. Anamorsin is found to be up-regulated in hepatocellular cancer, is considered to be a downstream effector of the receptor tyrosine kinase-Ras signalling pathway, and is essential in mouse definitive haematopoiesis [ (PUBMED:18299278) ]. In addition, it mediates the anti-apoptotic effects of various cytokines [ (PUBMED:14970183) ].

GO process:iron-sulfur cluster assembly (GO:0016226)
GO component:cytoplasm (GO:0005737)
GO function:iron-sulfur cluster binding (GO:0051536)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CIAPIN1