The domain within your query sequence starts at position 1156 and ends at position 1226; the E-value for the CID_GANP domain shown below is 1.6e-33.
MLTQLSEGLAAELTELTVTECVWETCSQELQSAVEIDQKVRVARCCEAVCAHLVDLFLAE EIFQTAKETLQ
CID_GANP |
![]() |
---|
PFAM accession number: | PF16766 |
---|---|
Interpro abstract (IPR031910): | CID is a domain found in higher eukaryotic germinal-cent associated nuclear protein (GANP) that binds to the transcription and mRNA export factor ENY2. The complex of these two proteins forms part of the TREX-2 complex that links transcription with nuclear messenger RNA export [ (PUBMED:22307388) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CID_GANP