The domain within your query sequence starts at position 1172 and ends at position 1313; the E-value for the CIMR domain shown below is 1.2e-17.
DQRFSTRIVFECAQTSGSPMFQFVNNCEYVFVWRTVEACPVIREEGDNCQVKDPRHGNLY DLKPLGLNDTIVSVGEYTYYLRVCGKLSSDVCSAHDGSKAVSSCQEKKGPQGFQKVAGLL SQKLTFENGLLKMNYTGGDTCH
CIMR |
![]() |
---|
PFAM accession number: | PF00878 |
---|---|
Interpro abstract (IPR000479): | The cation-independent mannose-6-phosphate receptor is a multi-functional transmembrane glycoprotein whose major function is to bind and transport M6P-bearing glycoproteins from the trans-Golgi network or the cell surface to lysosomes. It appears to mediate the uptake and processing of M6P-containing cytokines and peptide hormones, such as transforming growth factor-beta, leukemia inhibitory factor, and proliferin [ (PUBMED:19251055) ]. It also binds and internalizes the insulin-like growth factor II [ (PUBMED:16779663) ]. The cation-independent mannose-6-phosphate receptor contains 15 copies of a repeat [ (PUBMED:2957598) ]. This entry represents the repeats. |
GO process: | lysosomal transport (GO:0007041) |
GO function: | mannose binding (GO:0005537), signaling receptor activity (GO:0038023) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CIMR