The domain within your query sequence starts at position 876 and ends at position 1020; the E-value for the CIMR domain shown below is 1.9e-10.

TTYSTRIHLVCGRGFMNSHPIFTFNWECVVSFLWNTEAACPIQTITETDQACSIRDPSSG
FVFNLSPLNDSAQGHVVLGIGKTFVFNICGAMPACGTVAGKPAYGCEAETQIEDIKDLRP
QRPVGMERSLQLSAEGFLTLTYKGS

CIMR

 CIMR
PFAM accession number:PF00878
Interpro abstract (IPR000479):

The cation-independent mannose-6-phosphate receptor is a multi-functional transmembrane glycoprotein whose major function is to bind and transport M6P-bearing glycoproteins from the trans-Golgi network or the cell surface to lysosomes. It appears to mediate the uptake and processing of M6P-containing cytokines and peptide hormones, such as transforming growth factor-beta, leukemia inhibitory factor, and proliferin [ (PUBMED:19251055) ]. It also binds and internalizes the insulin-like growth factor II [ (PUBMED:16779663) ].

The cation-independent mannose-6-phosphate receptor contains 15 copies of a repeat [ (PUBMED:2957598) ]. This entry represents the repeats.

GO process:lysosomal transport (GO:0007041)
GO function:signaling receptor activity (GO:0038023), mannose binding (GO:0005537)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CIMR