The domain within your query sequence starts at position 675 and ends at position 734; the E-value for the CKAP2_C domain shown below is 6.9e-18.
MPEVQDMKLITPVRRSARIERTVARYPEMLQEHDVVVASLNELLEVDKTECFIFRENEAL
CKAP2_C |
---|
PFAM accession number: | PF15297 |
---|---|
Interpro abstract (IPR029197): | This entry represents the C terminus of CKAP2 (cytoskeleton-associated protein 2) and CKAP2L (cytoskeleton-associated protein 2-like). Mouse CKAP2 has been shown to possess microtubule stabilising properties [ (PUBMED:15504249) ] and is involved in regulating aneuploidy, cell cycle, and cell death in a p53-dependent manner [ (PUBMED:16061649) ]. In human, CKAMP2 is up-regulated in primary gastric cancers [ (PUBMED:12942315) ]. It has been shown that human CKAP2 is degraded by APC/C-Cdh1 during mitotic exit and that a tight regulation of CKAP2 protein level is important for mitotic progression [ (PUBMED:17376772) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CKAP2_C