The domain within your query sequence starts at position 130 and ends at position 228; the E-value for the CLAMP domain shown below is 3.1e-37.
HALIFCRQQGFSPEQTSAACAMLQDLHKACVATPLGNVEECYRYFTSVLFCHGIRRPPFS IDLFKEEQLLALADYVVNTYFRHFKLYKYVFTPQVRLDL
CLAMP |
![]() |
---|
PFAM accession number: | PF14769 |
---|---|
Interpro abstract (IPR032727): | This family represents one small subunit, C1a-32, of the C1a projection (the seventh projection of the flagellum in Chlamydomonas) [ (PUBMED:16188941) ]. Numerous studies have indicated that each of the seven projections associated with the central pair of microtubules in the flagellum plays a distinct role in regulating eukaryotic ciliary/flagellar motility. The C1a projection is a complex of proteins including PF6, C1a-86, C1a-34, C1a-32, C1a-18, and calmodulin. C1a projection is involved in modulating flagella beat frequency and this is mediated via the C1a-34, C1a-32, and C1a-18 sub-complex by modulating the activity of both the inner and outer dynein arms [ (PUBMED:22278927) ]. This entry also includes ciliary-associated calcium-binding coiled-coil protein 1 (Cabcoco1) from vertebrates. This is a calcium-binding protein which may have a role in control of sperm flagellar movement [ (PUBMED:26990073) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CLAMP