The domain within your query sequence starts at position 121 and ends at position 307; the E-value for the CLP1_P domain shown below is 2e-79.
GPTDVGKSTVCRLLLNYAVRLGRRPTYVELDVGQGSVSIPGTMGALYIERPADVEEGFSI QAPLVYHFGSTTPGTNIKLYNKITSRLADVFNQRCEVNRRASVSGCVINTCGWVKGYGYQ ALVHAASAFEVDVVVVLDQERLYNELKRDLPHFVRTVLLPKSGGVVERSKDFRRECRDER IREYFYG
CLP1_P |
---|
PFAM accession number: | PF16575 |
---|---|
Interpro abstract (IPR032319): | This entry represents the P-loop containing domain of Clp1, a mRNA cleavage and polyadenylation factor. Clp1 is essential for 3'-end processing of mRNAs. This domain carries the P-loop suggesting it is the region that binds adenine or guanine nucleotide [ (PUBMED:17151076) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CLP1_P