The domain within your query sequence starts at position 42 and ends at position 266; the E-value for the CMS1 domain shown below is 7.9e-35.
PEKTQQPTECFLTQTKEPKAEDSRKTRKWKKKKISDILAKSEPKPGTPEDLQKLIRDHYS SSRSVIELEELHLPDSCFLKANDLTHSLSSYLKEICPKWVKLRKTHNEKKSVLMLILCSS AVRALELIRSLTAFKGDAKVMKLFAKHIKVQEQVKLLEKRVIHLGVGTPGRIKELVKQDG LHLNPLKFLVFDWNWRDQKLRRMMDIPEIRKEVFELLDMGVFSLC
CMS1 |
![]() |
---|
PFAM accession number: | PF14617 |
---|---|
Interpro abstract (IPR032704): | This family includes fungal and plant Cms1 proteins and Cmss1 (Cms1 ribosomal small subunit homologue) from metazoa. Budding yeast Cms1 may play a role in the regulation of DNA replication and cell cycle control [ (PUBMED:11787774) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CMS1